The short version of Research chemical fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-01-20. Anything still debated is marked as such rather than presented as settled.
Outside its country of origin the compound is generally handled as a research chemical rather than an approved medicine. No regulatory approval from the United States Food and Drug Administration or the European Medicines Agency has been granted for human use. Identity and purity are normally checked by reverse-phase high-performance liquid chromatography, with mass spectrometry used to confirm the molecular mass. Lyophilised material is stored cold and desiccated, and repeated freeze-thaw cycles are avoided.
Published work on this peptide almost always uses intranasal delivery, with drops or a spray applied to the nasal mucosa. Some animal experiments have used subcutaneous or intraperitoneal injection, and a smaller number have compared routes directly. Oral administration is not a focus of the literature, because short peptides of this size are broken down by digestive enzymes and cross intestinal barriers poorly. How much of an intranasal dose reaches the bloodstream intact in humans remains an open question.
Once dissolved, the peptide is markedly less stable than the dry powder. Aqueous solutions are subject to backbone hydrolysis and to microbial growth when they are handled without sterile technique. Buffered solutions near neutral pH are common for short-term laboratory work, while acidic conditions are sometimes used to improve solubility. Analytical laboratories generally prepare working solutions fresh rather than storing them, and a residual water film left in a reopened vial can seed degradation even when the container appears dry.
Reversed-phase high-performance liquid chromatography is the standard technique for estimating peptide purity. The result is a peak-area percentage, which describes how much of the detected material elutes as the main peak in one run. Mass spectrometry confirms the molecular mass and can reveal truncated, adducted, or otherwise modified species. Amino acid analysis or tandem mass spectrometry can address sequence fidelity when identity is in doubt. None of these measurements, taken alone, establishes that a sample is fit for any specific purpose.
| Property | Value | Notes |
|---|---|---|
| Common route | Intranasal | Also injected in some animal work |
| Solubility class | Freely soluble in water | Solid form is hygroscopic |
| Typical storage | About -20 degrees Celsius | Keep desiccated and dark |
| Purity method | Reverse-phase HPLC | Reported as area percent |
| Confirmatory method | Mass spectrometry | Verifies expected molecular mass |
Naming for this compound is not fully standardised in English sources. The spelling Selanc appears in some transliterations, and catalogue entries may instead list the peptide sequence itself as the identifier. Reference material sometimes groups it with other short synthetic peptides studied for behavioural effects, which can create confusion when citations are compared. Distinguishing the exact sequence from related tuftsin analogues is therefore a practical first step when reviewing any dataset or specification sheet.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, frequently abbreviated as TKPRPGP. It was designed as a structural analogue of tuftsin, a naturally occurring tetrapeptide released by enzymatic cleavage of the immunoglobulin heavy chain. The two additional proline residues at the C-terminal end extend the parent chain and change how the molecule behaves in solution. The free peptide has a calculated molecular mass of approximately 751.9 g/mol and is generally supplied as a lyophilised white to off-white powder.
Reported pharmacological effects center on reduced anxiety-like behavior in animal models and on measures of memory and learning. Proposed contributing mechanisms include modulation of GABAergic signaling, shifts in monoamine turnover, and changes in the activity of enzymes that degrade neuropeptides. Effects on the expression of genes linked to neuroplasticity have also been described. No single molecular target is widely accepted, and whether the behavioral findings arise from one pathway or several remains an open question.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed as a stabilized analogue of tuftsin, a naturally occurring tetrapeptide fragment derived from the immunoglobulin heavy chain. The additional Pro-Gly-Pro segment at the carboxyl terminus is intended to slow enzymatic cleavage. The compound is usually described in the literature as a synthetic peptide with anxiolytic and cognitive-related activity, a label that reflects a research context rather than an approved therapeutic category.
Peptide bonds in selank are susceptible to hydrolysis under strongly acidic or basic conditions, and the terminal proline residues are vulnerable to exopeptidase activity in biological samples. Lyophilized powder stored dry at -20 °C typically remains stable for extended periods, whereas aqueous solutions degrade faster and may lose measurable purity within days to weeks depending on pH, temperature, and microbial load. Repeated freeze-thaw cycles promote aggregation and adsorption to container surfaces. For analytical work, solutions are usually prepared fresh, kept cold, and used within a single working day.
Handling follows standard practice for research peptides. Material is weighed in a low-humidity environment because the powder absorbs atmospheric moisture. Purity is reported as the percentage area of the main peak in a chromatogram, with specifications commonly set at 95 percent or higher; values below that threshold indicate the presence of truncated or modified species. Residual trifluoroacetate from purification is often present and may affect mass balance. Certificates of analysis should state the analytical method, the column and gradient used, and the lot-specific retention time so that results can be compared across suppliers.
Identity and purity of selank are established with reversed-phase high-performance liquid chromatography coupled to mass spectrometry. The peptide elutes from C18 columns with acetonitrile gradients in water containing trifluoroacetic acid or formic acid, and detection is usually performed by ultraviolet absorbance near 214 nm. Electrospray ionization in positive mode gives a doubly protonated ion near m/z 377, consistent with a mass of about 752 Da. Amino acid analysis or tandem mass spectrometry of fragment ions confirms the sequence. Because the molecule has no aromatic residues, it lacks a usable 280 nm chromophore, so low-wavelength detection or mass spectrometry is required.
Published clinical work is concentrated in Russian-language journals and generally involves small samples without independent replication. Systematic reviews in English note the shortage of randomised, placebo-controlled trials and the difficulty of verifying methods from translated reports. Outcome measures vary between studies, which complicates pooling of results. Interest in the compound as a cognitive or anxiolytic agent therefore rests on a thinner evidence base than the volume of citations suggests. Replication in well-powered trials with preregistered endpoints would be needed before firm conclusions about efficacy can be drawn.
Proposed mechanisms centre on the GABAergic system. Animal and tissue studies report changes in GABA-A receptor expression and reduced activity of GABA transaminase, the enzyme that degrades GABA. Effects on monoamine turnover, including serotonin and dopamine pathways, are also described, and a separate line of work links the peptide to increased expression of brain-derived neurotrophic factor in hippocampal tissue. Most of these findings come from rodent models and cell preparations. How the individual observations combine into a single coherent mode of action is not settled.
In the 2020s, conservative politicians in state legislatures introduced a growing number of bills that restrict the rights of LGBTQ people, especially transgender people. A strong supporter of LGBTQ rights, Harris denounced legislative attacks on transgender rights in states across the country. Exit polls showed that Harris had an 86%-12% advantage over Trump among voters who say that they are gay, lesbian, bisexual or transgender. Harris' lead among this group is the largest for a 21st-century Democratic presidential candidate with those reporting to be gay, lesbian, bisexual or transgender (2016–2024) and gay/lesbian/bisexual respondents (2000–2008). Exit poll results for the 2012 election are not available. Trump promised to roll back policies regarding transgender individuals. Harris and Walz campaigned as supporters of LGBTQ+ rights. Trump stated he would rescind Biden's Title IX protections "on day one" for transgender students using bathrooms, locker rooms, and pronouns that align with their gender identities. Trump stated he would enact a federal law that would recognize only two genders and claimed that being transgender is a concept only recently manufactured by "the radical left". Trump previously withdrew Title IX provisions that allowed transgender youth to have access to the bathrooms of their choice, and he attempted to roll-back several transgender-related policies in the Affordable Care Act. Trump repeated a false claim that children undergo transgender surgery while at school, without parental knowledge or consent.
=== EC 1.14.17 With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor === EC 1.14.17.1: dopamine β-monooxygenase EC |1.14.17.2: deleted, now included with EC 1.14.18.1 monophenol monooxygenase EC 1.14.17.3: peptidylglycine monooxygenase EC 1.14.17.4: aminocyclopropanecarboxylate oxidase
On June 17, 1999, the Board of PE Corporation announced a two-for-one split of PE Biosystems Group Common Stock. By June 2000, the genomics segment of the technology bubble was peaking. Celera Genomics (CRA) and PE Biosystems (PEB) were among five genetics pioneers leading at that time, along with Incyte Genomics, Human Genome Sciences, and Millennium Pharmaceuticals. All five of those stocks by then had exceeded a price above $100 per share in the market, before ultimately crashing back down.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
Sources: en.wikipedia.org
Like the world, the EU's greatest task is to replace fossil fuels with clean energy as fast as technology allows since protection of "life", and "improvement of the quality of the environment" are fundamental rights, and the highest policy goals of the EU. In international law, there is also 'the inherent right of all peoples to enjoy and utilize fully and freely their natural wealth and resources' such as clean air, and the right to 'the benefits of scientific progress', such as clean energy. The EU's overall target is to reduce toxic greenhouse gas emissions by 50–55% by 2030, and be carbon neutral or negative by 2050, and 32% renewable energy by 2030, though a 45% target by 2030 was proposed by the commission and backed by Parliament in 2022. Since the 2022 Russian invasion of Ukraine it aims to eliminate Russian fossil fuel imports as fast as possible. However laws such as the Hydrocarbons Directive 1994 still enable gas and oil extraction. It requires that licences are awarded based on technical and financial capability, methods, price, and previous conduct, that applicants are treated equally by objective and non-discriminatory criteria, and advertisements for tenders must be public. It has not yet required that existing licensees pay for the pollution and climate damage they have caused, nor sought to end extraction of gas and oil.
Also, recession that is left untreated can be maintained and the inflammation kept at bay with proper brushing and oral hygiene technique. On the other hand, if one desires to pursue corrective therapy, there are a wide variety of techniques ranging from autograft (one's own tissue, usually taken from the palate), allograft (another's tissue, cadaver tissue), xenograft (animal tissue, usually porcine or bovine) or simply repositioning of the tissue native to the site.
==== SAMe ==== S-Adenosyl methionine (SAMe) is available as a prescription antidepressant in Europe and an over-the-counter dietary supplement in the US. Evidence from 16 clinical trials with a small number of subjects, reviewed in 1994 and 1996 suggested it to be more effective than placebo and as effective as standard antidepressant medication for the treatment of major depression.
== Setting, hardening and curing == Cement starts to set when mixed with water, which causes a series of hydration chemical reactions. The constituents slowly hydrate and the mineral hydrates solidify and harden. The interlocking of the hydrates gives cement its strength. Contrary to popular belief, hydraulic cement does not set by drying out — proper curing requires maintaining the appropriate moisture content necessary for the hydration reactions during the setting and the hardening processes. If hydraulic cements dry out during the curing phase, the resulting product can be insufficiently hydrated and significantly weakened. A minimum temperature of 5 °C is recommended, and no more than 30 °C. The concrete at young age must be protected against water evaporation due to direct insolation, elevated temperature, low relative humidity and wind. The interfacial transition zone (ITZ) is a region of the cement paste around the aggregate particles in concrete. In the zone, a gradual transition in the microstructural features occurs. This zone can be up to 35 micrometer wide. Other studies have shown that the width can be up to 50 micrometer. The average content of unreacted clinker phase decreases and porosity decreases towards the aggregate surface. Similarly, the content of ettringite increases in ITZ.
Chondrocytes (, from Greek χόνδρος (chondros) 'cartilage' and κύτος (kytos) 'cell') are the only cells found in healthy cartilage. They produce and maintain the cartilaginous matrix, which consists mainly of collagen and proteoglycans. Although the word chondroblast is commonly used to describe an immature chondrocyte, the term is imprecise, since the progenitor of chondrocytes (which are mesenchymal stem cells) can differentiate into various cell types, including osteoblasts.
Sources: en.wikipedia.org
== Selected bibliography == Gitashri Naiya, Paromita Raha, Manas Mondal, Uttam Pal, Rajesh Saha, Susobhan Choudhury, Subrata Batabyal, Samir Kumar Pal, Dhananjay Bhattacharyya, Nakul Chandra Maiti, Siddhartha Roy (June 2016). "Conformational Selection Underpins Recognition of Multiple DNA sequences by Proteins and Consequent Functional Actions". Physical Chemistry Chemical Physics. 18 (31): 21618–21628. Bibcode:2016PCCP...1821618N. doi:10.1039/C6CP03278H. PMID 27426617.{{cite journal}}: CS1 maint: multiple names: authors list (link) Samir Kumar Pal, Susobhan Choudhury, Basusree Ghosh, Priya Singh, Raka Ghosh, Siddhartha Roy (June 2016). "Ultrafast Differential Flexibility of Cro-protein Binding Domains of Two Operator DNAs with Different Sequences". Physical Chemistry Chemical Physics. 18 (27): 17983–17990. Bibcode:2016PCCP...1817983C. doi:10.1039/C6CP02522F. PMID 27326896.{{cite journal}}: CS1 maint: multiple names: authors list (link) Sk Kayum Alam, Vinod Yadav, Swati Bajaj, Arindam Datta, Shamit Kumar Dutta, Madhumita Bhattacharyya, Santanu Bhattacharya, Subrata Debnath, Siddhartha Roy, Lisa A Boardman, Thomas Smyrk, Julian R. Molina, Saikat Chakrabarty, Shantanu Chowdhury, Debabrata Mukhopadhyay, Susanta Roychoudhury (April 2016). "DNA Damage-Induced Ephrin-B2 Reverse Signaling Promotes Chemoresistance and Drives EMT in Colorectal Carcinoma Harboring Mutant p53". Cell Death and Differentiation. 23 (4): 707–722. doi:10.1038/cdd.2015.133. PMC 4986638.
Borgo Dora hosts several places, such as: Piccola Casa della Divina Provvidenza ('Little House of the Divine Providence'), also known as Cottolengo, a charitable organisation which has been operating for almost 200 years in the city; Arsenale della Pace ('Arsenal of Peace'), a former weapons factory that currently hosts the headquarters of SERMIG (Servizio Missionario Giovani), a nonprofit association which assists poor and homeless people; Caserma Cavalli ('Cavalli Barracks'), a former barracks topped by a clock tower which now hosts Scuola Holden, a storytelling and performing arts school; the Cortile del Maglio ('Mallet Courtyard'), a covered pedestrian area featuring bars and clubs. Across from Cortile del Maglio and Arsenale della Pace stands a wide pedestrian area which features a hot air balloon, a clear allusion to the neighbourhood's old name Balon: recently installed, the balloon is open to public which can now take a view of the city from this new high observation point. Right at the borders of Borgo Dora stands part of Porta Palazzo open market which hosts the New Exhibition Hall, designed by the Italian architect Massimiliano Fuksas. The building has replaced the Clothes Market, one of the four covered pavilions of Porta Palazzo market, but unfortunately, this glass green-shaded building has been highly criticised because of its lack of usability for commercial activities, albeit an example of contemporary architecture. Another interesting building at the borders of the neighbourhood is Porta Milano (a.k.a.
=== 18 January === Australian defence minister Richard Marles stated that Australian soldiers would be deployed in the UK to train Ukrainian soldiers in "infantry tactics in an urban, wooded and basic" settings.
Medical Oncology, which involves treatment of cancer with chemicals, biological products and immunotherapy Radiation Oncology, or the careful use of high-energy radiation to treat cancer The goal of radiation therapy is to deliver a precisely measured dose to the cancerous tumor, while protecting normal tissue around the tumor Hematology, or the diagnosis and treatment of diseases of the blood and blood forming organs Genetic Testing, a type of medical test that identifies changes in chromosomes, genes, or proteins. Most of the time, testing is used to find changes that are associated with inherited disorders Clinical Trials, studies that evaluate the effectiveness of new drugs and strategies In addition to providing cancer care, SOMC also holds annual breast cancer awareness events (referred to as “pink outs” or by the name “Paint It Pink”) to coincide with October's designation as Breast Cancer Awareness Month. The events have received positive community feedback and helped raise money for the SOMC Breast Cancer Compassion Fund. The Breast Cancer Compassion Fund provides money to help support breast cancer patients with expenses such as utilities, medications, transportation and common necessities needed during cancer care. In 2012, Portsmouth Mayor David Malone declared October 20 “Paint It Pink Day.” That year's event also grew to include a 5k run/walk. SOMC has also worked to raise breast cancer awareness by creating a “Pink Glove Dance” YouTube video featuring local residents and hospital employees.
Gerald (Jerry) Ledlow, Dean of UT Health Science Center at Tyler School of Community and Rural Health; Erich Heneke, Director of Business Integrity Continuity in Mayo Clinic's Supply Chain Management (SCM); Mike Loughrin, President of Transformance Advisors; Renata Rieder, Head of Service Management at Federal Office of Information Technology, Systems and Telecommunication for the Government of Switzerland; David Jacoby, President of Boston Strategies International; and Jorge A. Morales, former RFID technology advisor to the Mexican Government.
Sources: en.wikipedia.org
Most published work uses intranasal application, either as drops or as a nasal spray. Injection routes appear in a smaller set of animal experiments. Oral use is uncommon in the literature because peptide breakdown and poor absorption limit this route.
Reported human trials are few, brief and originate mainly from one country. They describe effects on anxiety-related measures, but sample sizes are small and reporting is limited. The results are widely regarded as preliminary rather than confirmed.
Reverse-phase liquid chromatography is used to assess purity and separation of related impurities. Mass spectrometry confirms that the observed molecular mass matches the expected peptide. A certificate of analysis from the supplier is the usual document of record.
Sealed, desiccated storage at -20 °C or colder is the standard recommendation for research-grade material. Vials should reach room temperature before they are opened, which limits condensation. Repeated temperature cycling is discouraged.